RNF168 Rabbit Polyclonal Antibody

SKU: orb578832

Description

Rabbit polyclonal antibody to RNF168

Research Area

Cell Biology, Immunology & Inflammation, Molecular Biology, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RNF168
• Target: RNF168
• Protein Sequence: Synthetic peptide located within the following region: PCFSAKRRKVSPESSPDQEETEINFTQKLIDLEHLLFERHKQEEQDRLLA
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RIDL, hRNF168

Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/ml.

Human Brain

WB Suggested Anti-RNF168 Antibody Titration: 0.5 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

RNF168

UniProt

Q8IYW5

RefSeq (Protein):NP_689830