RNF139 monoclonal antibody (M01), clone 3D10

• Catalog Number: orb2291419
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RNF139.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3D10
• Tested applications: ELISA, IHC-P, WB
• Reactivity: Human
• Isotype: IgG1 Kappa
• Immunogen: RNF139 (NP_009149, 565 a.a. ~ 664 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: HYFHALCLRKWLYIQDTCPMCHQKVYIEDDIKDNSNVSNNNGFIPPNETPEEAVREAAAESDRELNEDDSTDCDDDVQRERNGVIQHTGAAAEEFNDDTD
• NCBI: NP_009149
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RNF139 is approximately 0.03 ng/ml as a capture antibody.

Immunoperoxidase of monoclonal antibody to RNF139 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3 ug/ml]

RNF139 monoclonal antibody (M01), clone 3D10 Western Blot analysis of RNF139 expression in HepG2.

Western Blot detection against Immunogen (36.63 KDa).