You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291833 |
---|---|
Category | Antibodies |
Description | Mouse monoclonal antibody raised against a partial recombinant RIPK2. |
Species/Host | Mouse |
Clonality | Monoclonal |
Clone Number | 6F7 |
Tested applications | ELISA, IHC-P, WB |
Reactivity | Human, Mouse, Rat |
Isotype | IgG2a Kappa |
Immunogen | RIPK2 (AAH04553, 431 a.a. ~ 540 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Conjugation | Unconjugated |
Protein Sequence | LQPGIAQQWIQSKREDIVNQMTEACLNQSLDALLSRDLIMKEDYELVSTKPTRTSKVRQLLDTTDIQGEEFAKVIVQKLKDNKQMGLQPYPEILVVSRSPSLNLLQNKSM |
NCBI | AAH04553 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | In 1x PBS, pH 7.4 |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Detection limit for recombinant GST tagged RIPK2 is approximately 0.1 ng/ml as a capture antibody.
Immunoperoxidase of monoclonal antibody to RIPK2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]
RIPK2 monoclonal antibody (M02), clone 6F7 Western Blot analysis of RIPK2 expression in HeLa.
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in NIH/3T3.
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in PC-12.
RIPK2 monoclonal antibody (M02), clone 6F7. Western Blot analysis of RIPK2 expression in Raw 264.7.
Western Blot analysis of RIPK2 expression in transfected 293T cell line by RIPK2 monoclonal antibody (M02), clone 6F7. Lane 1: RIPK2 transfected lysate (61.2 KDa). Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (37.84 KDa).