RIPK2 Rabbit Polyclonal Antibody

• Catalog Number: orb592676
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RIPK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RIPK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: RIPK2
• UniProt ID: O43353
• Protein Sequence: Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT
• NCBI: NP_003812
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CCK, RICK, RIP2, CARD3, GIG30, CARDIAK
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Rat thyrocytes-FRTL-5, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Texas Red, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: RIPK2 Blue: DAPI, Gene Name: RIPK2.

WB Suggested Anti-RIPK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate.