Rgs2 Rabbit Polyclonal Antibody

SKU: orb578614

Description

Rabbit polyclonal antibody to Rgs2

Research Area

Cell Biology, Epigenetics & Chromatin, Pharmacology & Drug Discovery, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Porcine, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Rgs2
• Protein Sequence: Synthetic peptide located within the following region: NSSAPGKPKTGKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAF
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GO, GOS8

Spleen

WB Suggested Anti-Rgs2 Antibody Titration: 0.2-1 ug/ml, Positive Control: Mouse Kidney.

Quick Database Links

Gene Symbol

Rgs2

UniProt

P41220

RefSeq (Protein):NP_033087