RGS19 Rabbit Polyclonal Antibody

• Catalog Number: orb574913
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RGS19
• Target: RGS19
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human RGS19
• Protein Sequence: Synthetic peptide located within the following region: PTPHEAEKQITGPEEADRPPSMSSHDTASPAAPSRNPCCLCWCCCCSCSW
• UniProt ID: P49795
• MW: 25kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: GAIP, RGSGAIP
• Research Area: Cell Biology, Immunology & Inflammation, Pharmacol
• Note: For research use only
• NCBI: NP_005864

Rabbit Anti-RGS19 Antibody, Paraffin Embedded Tissue: Human bronchiole epithelium, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-RGS19 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Lung lysate.