You have no items in your shopping cart.
Cart summary
Item 1 of 1
RGL1 Rabbit Polyclonal Antibody
Catalog Number: orb585957
| Catalog Number | orb585957 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RGL1 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Reactivity | Human |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 91kDa |
| Target | RGL1 |
| UniProt ID | Q9NZL6 |
| Protein Sequence | Synthetic peptide located within the following region: ADASTTSPKPRKSMVKRLSLLFLGSDMITSPTPTKEQPKSTASGSSGESM |
| NCBI | NP_055964 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | RGL Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-RGL1 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
- Item 1 of 2
Anti-RGL1 Antibody [orb215076]
IH, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
