You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
RFC5 Rabbit Polyclonal Antibody
Catalog Number: orb325254
| Catalog Number | orb325254 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RFC5 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Yeast, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RFC5 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 38kDa |
| Target | RFC5 |
| UniProt ID | P40937 |
| Protein Sequence | Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE |
| NCBI | NP_031396 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti MGC1155 antibody, anti RFC36 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Human kidney
WB Suggested Anti-RFC5 Antibody Titration: 1 ug/mL, Positive Control: Jurkat cell lysate, RFC5 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.
- Item 1 of 4
- Item 1 of 1
Anti-RFC5 Antibody [orb382007]
WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 1
- Item 1 of 1
