Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RER1 Rabbit Polyclonal Antibody

SKU: orb330494

Description

Rabbit polyclonal antibody to RER1

Research Area

Cell Biology

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RER1
TargetRER1
Protein SequenceSynthetic peptide located within the following region: GIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFKF
Molecular Weight23kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti RP4-740C4.2 antibody

Similar Products

  • RER1 Rabbit Polyclonal Antibody (HRP) [orb2116394]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    HRP

    100 μl
  • RER1 Rabbit Polyclonal Antibody (FITC) [orb2116395]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    FITC

    100 μl
  • RER1 Rabbit Polyclonal Antibody (Biotin) [orb2116396]

    IHC,  WB

    Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

    Rabbit

    Polyclonal

    Biotin

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RER1 Rabbit Polyclonal Antibody

Rabbit Anti-RER1 Antibody, Catalog Number: orb330494, Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver, Observed Staining: Cytoplasm in hepatocytes, strong signal, very wide tissue distribution, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 – 2.0 sec, Protocol located in Reviews and Data.

RER1 Rabbit Polyclonal Antibody

WB Suggested Anti-RER1 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:62500, Positive Control: 293T cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_008964

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

RER1 Rabbit Polyclonal Antibody (orb330494)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry