RELA Rabbit Polyclonal Antibody

SKU: orb573616

Description

RELA Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of RELA. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the middle region of human RELA. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology, Protein Biochemistry, Signal Transduction, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RELA
• Target: RELA
• Protein Sequence: Synthetic peptide located within the following region: VTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS
• Molecular Weight: 60kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

p65, CMCU, NFKB3

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Lanes: Lane 1: 50 ug HCT116 cell lysate, Lane 2: 50 ug HT-29 cell lysate, Lane 3: 50 ug T47D cell lysate, Lane 4: 50 ug HEK-293T cell lysate, Lane 5: 50 ug MCF7 cell lysate, Lane 6: 50 ug MDA-MB-231 cell lysate, Primary Antibody dilution: 2 ug/ml, Secondary Antibody: Anti-Rabbit HRP, Secondary Antibody dilution: Gene Name: RELA.

RELA antibody - middle region (orb573616) validated by WB using HCT116/Ht-29/T47D/HEK-293T/MCF/MDA-MB-231 cell lines at 2 ug/ml.

WB Suggested Anti-RELA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Jurkat cell lysate.

Quick Database Links

Gene Symbol

RELA

UniProt

Q04206

RefSeq (Protein):NP_068810