Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Rel Rabbit Polyclonal Antibody

SKU: orb329896

Description

Rel Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of Rel. It is suitable for WB application. The immunogen is a synthetic peptide corresponding to a region of Mouse. This antibody reacts with Human, Mouse samples and is predicted to react with Bovine, Canine, Equine, Guinea pig, Rabbit, Rat. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetRel
Protein SequenceSynthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
Molecular Weight65kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti c-Rel antibody

Similar Products

  • NFKB p65 Rabbit Polyclonal Antibody [orb11118]

    FC,  ICC

    Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Rat, Sheep, Zebrafish

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • NFKB p65 Rabbit Polyclonal Antibody [orb312399]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  KO/KD Validated,  WB

    Bovine, Canine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-NFKB p65 (Ser468) Rabbit Polyclonal Antibody [orb6503]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-NFKB p65 (Ser536) Rabbit Polyclonal Antibody [orb6504]

    WB

    Human, Monkey, Rat

    Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Phospho-NFKB p65 (Ser281) Rabbit Polyclonal Antibody [orb185656]

    FC,  WB

    Bovine, Canine, Equine, Porcine, Rat, Sheep

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rel Rabbit Polyclonal Antibody

Rabbit Anti-REL Antibody, Catalog Number: orb329896, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

Rel Rabbit Polyclonal Antibody

WB Suggested Anti-REL Antibody, Positive Control: Lane 1: 100 ug mouse liver, Lane 2: 100 ug mouse brain, Lane 3: 100 ug mouse heart, Lane 4: 100 ug mouse kidney, Lane 5: 100 ug mouse lung, Lane 6: 100 ug mouse thymus, Lane 7: 100 ug mouse spleen, Lane 8: 100 ug mouse testis, Lane 9: 100 ug mouse HeLa, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:10000.

Rel Rabbit Polyclonal Antibody

WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033070

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Rel Rabbit Polyclonal Antibody (orb329896)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry