Rel Rabbit Polyclonal Antibody

SKU: orb329896

Description

Rabbit polyclonal antibody to Rel

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
• Target: Rel
• Protein Sequence: Synthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti c-Rel antibody

Rabbit Anti-REL Antibody, Catalog Number: orb329896, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

WB Suggested Anti-REL Antibody, Positive Control: Lane 1: 100 ug mouse liver, Lane 2: 100 ug mouse brain, Lane 3: 100 ug mouse heart, Lane 4: 100 ug mouse kidney, Lane 5: 100 ug mouse lung, Lane 6: 100 ug mouse thymus, Lane 7: 100 ug mouse spleen, Lane 8: 100 ug mouse testis, Lane 9: 100 ug mouse HeLa, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:10000.

WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Lung.

Quick Database Links

Gene Symbol

Rel

UniProt

A4QPD3

RefSeq (Protein):NP_033070