Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Rel Rabbit Polyclonal Antibody

SKU: orb329896

Description

Rabbit polyclonal antibody to Rel

Research Area

Cancer Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rabbit, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
TargetRel
Protein SequenceSynthetic peptide located within the following region: KAILEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIF
Molecular Weight65kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti c-Rel antibody

Similar Products

  • RelB Rabbit Polyclonal Antibody [orb6870]

    IF,  IHC-Fr,  IHC-P,  WB

    Rabbit

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Caspase 4/CASP4 Rabbit Polyclonal Antibody [orb402282]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • C-REL Rabbit Polyclonal Antibody [orb5913]

    FC,  IF,  IHC-Fr,  IHC-P

    Equine, Gallus, Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • GGTLA1 Antibody (N-term) [orb1929300]

    FC,  IHC-P,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
  • Caspase-5/CASP5 Rabbit Polyclonal Antibody [orb745901]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rel Rabbit Polyclonal Antibody

Rabbit Anti-REL Antibody, Catalog Number: orb329896, Formalin Fixed Paraffin Embedded Tissue: Human Bone Marrow Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5 - 2.0 sec.

Rel Rabbit Polyclonal Antibody

WB Suggested Anti-REL Antibody, Positive Control: Lane 1: 100 ug mouse liver, Lane 2: 100 ug mouse brain, Lane 3: 100 ug mouse heart, Lane 4: 100 ug mouse kidney, Lane 5: 100 ug mouse lung, Lane 6: 100 ug mouse thymus, Lane 7: 100 ug mouse spleen, Lane 8: 100 ug mouse testis, Lane 9: 100 ug mouse HeLa, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-AP, Secondry Antibody Dilution: 1:10000.

Rel Rabbit Polyclonal Antibody

WB Suggested Anti-Rel Antibody Titration: 0.2-1 ug/mL, Positive Control: Mouse Lung.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_033070

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Rel Rabbit Polyclonal Antibody (orb329896)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry