You have no items in your shopping cart.
Cart summary
Item 1 of 1
REG4 Rabbit Polyclonal Antibody
Catalog Number: orb584721
| Catalog Number | orb584721 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to REG4 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Bovine, Canine, Mouse, Porcine, Rat |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human REG4 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 17 kDa |
| Target | REG4 |
| UniProt ID | Q9BYZ8 |
| Protein Sequence | Synthetic peptide located within the following region: RSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNKHCAEMSSNNN |
| NCBI | NP_114433.1 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | GISP, RELP, REG-IV Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Thymus Tumor, Antibody dilution: 1.0 ug/ml.
- Item 1 of 3
- Item 1 of 2
Anti-REG4 Antibody [orb234950]
IH, WB
Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
30 μl, 100 μl, 200 μl - Item 1 of 3
- Item 1 of 2
Anti-REG4 Antibody [orb1422886]
IHC, WB
Human, Mouse, Porcine, Rat
Rabbit
Polyclonal
Unconjugated
100 μl, 50 μl - Item 1 of 1
