RecombinantTRAIL/Apo2L,Human

• Catalog Number: orb1494764
• Category: Proteins
• Description: TRAIL/Apo2L, also known as Tumor Necrosis Factor Super-Family 10 (TNFSF10), is a pleiotropic cytokine thatbelongs to the TNF superfamily. The full length TRAIL expressed in vivo is a Type II transmembrane protein, although the soluble form also exists and functions. TRAIL has four major receptors: two death receptors DR4 and DR5, two decoy receptors DcR1 and DcR2. TRAIL binds to the death receptors, recruits the FAS-associated death domain, activates caspases 8 and 10, and eventually leads to apoptosis. Because of its antitumor potential, TRAIL is actively studied as a therapeutic agent. On the other hand, abnormal expression of TRAIL in small arteries can induce the proliferation of smooth muscle cells, resulting in increasing vascular remodeling and pulmonary arterial hypertension. Recombinant human TRAIL/Apo2L (rhTRAIL) produced in E.coli is a single non-glycosylated polypeptide chain containing 169 amino acids. A fully biologically active molecule, rhTRAIL has a molecular mass of 19.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques at GenScript.
• Form/Appearance: Lyophilized after extensive dialysis against PBS.
• Buffer/Preservatives: Lyophilized after extensive dialysis against PBS.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Purification: > 95% as analyzed by SDS-PAGE and HPLC.
• Protein Sequence: MVRERGPQRVAAHITGTRGRSNTLSSPNSKNEKALGRKINSWESSRSGHSFLSNLHLRNGE LVIHEKGFYYIYSQTYFRFQEEIKENTKNDKQMVQYIYKYTSYPDPILLMKSARNSCWSK DAEYGLYSIYQGGIFELKENDRIFVSVTNEHLIDMDHEASFFGAFLVG
• MW: 19.6 kDa, observed by reducing SDS-PAGE.
• Application notes: Reconstituted in ddH2O or PBS at 100 μg/ml.
• Endotoxins: < 0.2 EU/μg, determined by LAL method.
• Source: Escherichia coli.
• Biological Activity: ED50 2.5 × 10ˆ4 units/mg.
• Storage: Lyophilized recombinant human TRAIL/Apo2L (rhTRAIL) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, rhTRAIL remains stable up to 2 weeks at 4°C or up to 3 months at -20°C.
• Alternative names: TNF-related apoptosis-inducing Ligand, TNFSF10, Ap
• Note: For research use only
• Expiration Date: 6 months from date of receipt.