You have no items in your shopping cart.
Description
Research Area
Infectious Disease & Virology
Images & Validation
−
Key Properties
−| Biological Origin | Influenza A virus (strain A/Korea/426/1968 H2N2) |
|---|---|
| Expression Region | 1-97 |
| Protein Length | full length protein |
| Protein Sequence | MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHFILWILDRLFFKCIYRFFKHGLK RGPSTEGVPESMREEYRKEQQSAVDADDSHFVSIELE |
Storage & Handling
−| Storage | Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Matrix protein 2, Proton channel protein M2
Similar Products
−- Item 1 of 1
Recombinant Influenza A virus Matrix protein 2 (M), partial [orb1785061]
Greater than 85% as determined by SDS-PAGE.
18.6 kDa
E.coli
1 mg, 100 μg, 20 μg - Item 1 of 1
Recombinant Influenza A virus Matrix protein 2 (M) [orb2935465]
Greater than 95% as determined by SDS-PAGE.
12.3 kDa
in vitro E.coli expression system
100 μg, 20 μg - Item 1 of 1
Recombinant Influenza A virus Matrix protein 2 (M) [orb2935474]
Greater than 95% as determined by SDS-PAGE.
12.0 kDa
in vitro E.coli expression system
100 μg, 20 μg - Item 1 of 1
Recombinant Influenza A virus Matrix protein 2 (M) [orb2935490]
Greater than 95% as determined by SDS-PAGE.
12.1 kDa
in vitro E.coli expression system
100 μg, 20 μg - Item 1 of 1
Recombinant Influenza A virus Matrix protein 2 (M) [orb2935491]
Greater than 90% as determined by SDS-PAGE.
12.2 kDa
in vitro E.coli expression system
100 μg, 20 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 15-40 working days