You have no items in your shopping cart.
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial
SKU: orb1652783
Description
Research Area
Pharmacology & Drug Discovery; Cell Biology
Images & Validation
−
Key Properties
−| Expression System | E.coli |
|---|---|
| Immunogen | Expression Region: 300-555aa; Sequence Info: Partial |
| Tag | N-terminal 6xHis-SUMO-tagged |
| MW | 45.5 kDa |
| Protein Sequence | LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
|---|---|
| Buffer/Preservatives | Tris-based buffer, 50% glycerol |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Neural-specific protein-tyrosine phosphatase; Striatum-enriched protein-tyrosine phosphatase; STEP

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial (orb1652783)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review