Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial

SKU: orb1652783

This product can be custom made

Description

Research Area

Pharmacology & Drug Discovery; Cell Biology

Images & Validation

−

Key Properties

−

Expression System	E.coli
Immunogen	Expression Region: 300-555aa; Sequence Info: Partial
Tag	N-terminal 6xHis-SUMO-tagged
MW	45.5 kDa
Protein Sequence	LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY

Storage & Handling

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Buffer/Preservatives	Tris-based buffer, 50% glycerol
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

Neural-specific protein-tyrosine phosphatase; Striatum-enriched protein-tyrosine phosphatase; STEP

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Quick Database Links

UniProt

P54829

UniProt Details

−

No UniProt data available

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Protein Handling and Storage Guide

Protein Handling Guide

View Guide

Find More Protocols