You have no items in your shopping cart.
Cart summary
Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial
Catalog Number: orb1652783
| Catalog Number | orb1652783 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Tyrosine-protein phosphatase non-receptor type 5(PTPN5),partial |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Buffer/Preservatives | Tris-based buffer, 50% glycerol |
| Immunogen | Expression Region: 300-555aa; Sequence Info: Partial |
| Protein Sequence | LQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHTPIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLY |
| UniProt ID | P54829 |
| MW | 45.5 kDa |
| Expression System | E.coli |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Alternative names | Neural-specific protein-tyrosine phosphatase; Stri Read more... |
| Note | For research use only |
