RCOR1 Rabbit Polyclonal Antibody

SKU: orb576992

Description

Rabbit polyclonal antibody to RCOR1

Research Area

Epigenetics & Chromatin, Protein Biochemistry

Images & Validation

−

Item 1 of 1

Tested Applications	WB
Reactivity	Human
Predicted Reactivity	Bovine, Canine, Equine, Guinea pig, Mouse

Related Conjugates & Formulations

−

Biotin

FITC

HRP

Key Properties

−

Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human RCOR1
Target	RCOR1
Protein Sequence	Synthetic peptide located within the following region: DEVLQEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYAS
Molecular Weight	53kDa
Purification	Affinity Purified
Conjugation	Unconjugated

Storage & Handling

−

Storage	Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	0.5 mg/ml
Expiration Date	12 months from date of receipt.
Disclaimer	For research use only

Alternative Names

−

RCOR, COREST

CoREST2 Rabbit Polyclonal Antibody [orb182680]

Applications:	ELISA, ICC, IF, IHC-Fr, IHC-P, WB
Predicted Reactivity:	Canine, Equine, Gallus, Mouse, Porcine, Rat, Sheep
Reactivity:	Human
Species/Host:	Rabbit
Clonality:	Polyclonal
Conjugation:	Unconjugated

Sizes Available: 50 μl, 100 μl, 200 μl

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

WB Suggested Anti-RCOR1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Jurkat cell lysate. RCOR1 is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

RCOR1

UniProt

Q9UKL0

RefSeq (Protein):NP_055971

UniProt Details

−

No UniProt data available

NCBI Reference Sequences

−

Associated Accession Numbers

Curated reference sequences for the gene transcript and protein product

Protein	NP_055971

Documents Download

Datasheet

Product Information

Download

Request a Document

Protocol Information

Western Blot (IB, immunoblot)

View Protocol

Find More Protocols