RBM7 Rabbit Polyclonal Antibody

• Catalog Number: orb577792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RBM7
• Target: RBM7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBM7
• Protein Sequence: Synthetic peptide located within the following region: SFNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYR
• UniProt ID: Q9Y580
• MW: 31 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FLJ11153
• Note: For research use only
• NCBI: NP_057174

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human Lung Tumor, Antibody Dilution: 1 ug/ml.

Rabbit Anti-RBM7 antibody, Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-RBM7 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Liver.