Cart summary

You have no items in your shopping cart.

    RbAp48/RBBP4 Antibody

    Catalog Number: orb334529

    DispatchUsually dispatched within 5-10 working days
    $ 520.00
    Catalog Numberorb334529
    CategoryAntibodies
    DescriptionRbAp48/RBBP4 Antibody
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsFC, ICC, IF, IHC-Fr, WB
    Predicted ReactivityHamster
    ReactivityHuman, Mouse, Rat
    IsotypeRabbit IgG
    ImmunogenA synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
    ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
    Dilution rangeWestern blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, By HeatImmunohistochemistry (Frozen Section), 0.5-1μg/ml Immunocytochemistry/Immunofluorescence, 2μg/ml Flow Cytometry, 1-3μg/1x106 cells
    Form/AppearanceLyophilized
    ConjugationUnconjugated
    MW47656 MW
    UniProt IDQ09028
    StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
    Alternative namesHistone-binding protein RBBP4;Chromatin assembly f
    Read more...
    NoteFor research use only
    Application notesTested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. . Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
    Expiration Date12 months from date of receipt.
    RbAp48/RBBP4 Antibody

    Flow Cytometry analysis of 293T cells using anti-RbAp48 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

    RbAp48/RBBP4 Antibody

    WB analysis of RbAp48 using anti-RbAp48 antibody.Lane 1:Rat Brain Tissue;2:Mouse Liver Tissue;3:Mouse Lung Tissue;4:HELA Cell;5:JURKAT Cell.

    RbAp48/RBBP4 Antibody

    IF analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in immunocytochemical section of A431 cells.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Human Intestinal Cancer Tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Mouse Liver Tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in paraffin-embedded section of Rat Intestine Tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of mouse small intestine tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of human placenta tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of rat small intestine tissue.

    RbAp48/RBBP4 Antibody

    IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in frozen section of mouse liver tissue.

    • RbAp48 RBBP4 Antibody (monoclonal, 9F3) [orb443139]

      IHC,  WB

      Human, Mouse, Rat

      Mouse

      Monoclonal

      Unconjugated

      10 μg, 100 μg
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars