RbAp48 RBBP4 Antibody (monoclonal, 9F3)

• Catalog Number: orb443139
• Category: Antibodies
• Description: RbAp48 RBBP4 Antibody (monoclonal, 9F3)
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 9F3
• Tested applications: IHC, WB
• Reactivity: Human, Mouse, Rat
• Isotype: Mouse IgG1
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human RbAp48 (395-425aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
• Concentration: Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
• Dilution range: Western blot, 0.1-0.5μg/ml Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml
• Form/Appearance: Lyophilized
• Conjugation: Unconjugated
• MW: 55 kDa
• UniProt ID: Q09028
• Storage: Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
• Alternative names: Histone-binding protein RBBP4; Chromatin assembly
• Note: For research use only
• Application notes: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Expiration Date: 12 months from date of receipt.

Flow Cytometry analysis of SiHa cells using anti-RbAp48 antibody (Blue line).Isotype control antibody (Green line) was rabbit IgG .Unlabelled sample (Red line) was also used as a control.

WB analysis of RbAp48 using anti-RbAp48 antibody.Lane 1:human A549 Cell;2:human Jurkat Cell;3:human HeLa Cell;4:human PANC-1 Cell.

WB analysis of RbAp48 using anti-RbAp48 antibody.Lane 1:human Jurkat cell;2:rat thymus tissue;3:mouse spleen tissue.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of human placenta tissue.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of human intestinal cancer tissue.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of human mammary cancer tissues.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of human intestinal cancer tissues.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of human lung cancer tissues.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of mouse brain tissues.

IHC analysis of RbAp48 using anti-RbAp48 antibody.RbAp48 was detected in paraffin-embedded section of rat brain tissues.