RB1CC1 Rabbit Polyclonal Antibody

• Catalog Number: orb581097
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RB1CC1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RB1CC1
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 183kDa
• Target: RB1CC1
• UniProt ID: Q8TDY2
• Protein Sequence: Synthetic peptide located within the following region: SGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV
• NCBI: NP_001077086
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CC1, ATG17, FIP200, PPP1R131
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Rabbit Anti-RB1CC1 Antibody, Catalog Number: orb581097, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Peripheral membrane, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RB1CC1 Antibody Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate. RB1CC1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.