RB1 Rabbit Polyclonal Antibody

SKU: orb574559

Description

Rabbit polyclonal antibody to RB1

Research Area

Cancer Biology, Cell Biology, Epigenetics & Chromatin, Stem Cell & Developmental Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RB1
• Target: RB1
• Protein Sequence: Synthetic peptide located within the following region: IMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSI
• Molecular Weight: 106kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

RB, pRb, OSRC, pp110, p105-Rb, PPP1R130, p110-RB1

WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Daudi cell lysate, RB1 is strongly supported by BioGPS gene expression data to be expressed in Human Daudi cells.

Quick Database Links

Gene Symbol

RB1

UniProt

P06400

RefSeq (Protein):NP_000312