Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 4-5 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Rat Sncg protein
Catalog Number orb704771
ReactivityRat
ConjugationUnconjugated
Target Sncg
Alternative Names
Product Properties
Form/Appearance If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Storage The shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Tag N-terminal 6xHis-tagged, Full Length
Note For research use only.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Protein Sequence MDVFKKGFSIAREGVVGAVEKTKQGVTEAAEKTKEGVMYVGTKTKGERGTSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIVVTTGVVRKEDLEPPAQDQEAKEQEEGEEAKSGGD
Purity >85% as determined by SDS-PAGE.
MW 17.1 kDa
Source E.coli
Expression Region 1-123aa
Uniprot ID Q63544
Product Description

Recombinant Rat Gamma-synuclein(Sncg)

Reviews
Write Your Own Review
You're reviewing:Rat Sncg protein - orb704771
Your Rating