Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 1 to 3 weeks
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Rat Mmp2 protein
Catalog Number orb244378
Species/HostRat
ConjugationUnconjugated
Target Mmp2
Alternative Names
Product Properties
Form/Appearance Tris-based buffer, 50% glycerol
Storage Store at -20°C. for extended storage, conserve at -20°C or -80°C.
Note For research use only.
Protein Sequence YNFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFNGREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNGDGQPCKFPFRFQGTSYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKYESCT
Purity >90% as determined by SDS-PAGE.
MW 78.1 kDa
Source E. coli
Uniprot ID P33436
Product Description

Recombinant rat 72 kDa type IV collagenase

Application Notes
Application Notes Full length of 72 kDa type IV collagenase chain of His-SUMO-tag and expression region is 110-662aa
Reviews
Write Your Own Review
You're reviewing:Rat Mmp2 protein - orb244378
Your Rating