Rat Il18 protein

Catalog Number: orb54096

Catalog Number	orb54096
Category	Proteins
Description	Recombinant rat Il18 protein
Tag	N-terminal 6xHis-tagged
Form/Appearance	Liquid or Lyophilized powder
Purity	Greater than 90% as determined by SDS-PAGE.
MW	22.3 kDa
UniProt ID	P97636
Protein Sequence	HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Protein Length	Full Length of Mature Protein
Source	E.coli
Biological Origin	Rattus norvegicus (Rat)
Expression Region	37-194aa
Endotoxins	Not test.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Alternative names	Interferon gamma-inducing factor , IFN-gamma-induc Read more...
Note	For research use only
Application notes	N-terminal 6xHis-tagged: N-terminal 6xHis-tagged31-183AA: 37-194AAPartial: Full Length
Expiration Date	6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.