Rat Dpp4 protein

SKU: orb383085

Description

This Rat Dpp4 protein spans the amino acid sequence from region 638-767aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation

Images & Validation

• Application Notes:
  E.coli and Yeast N-terminal 6xHis-SUMO-tagged Partial

Key Properties

• Source: E.coli
• Biological Origin: Rattus norvegicus (Rat)
• Tag: N-terminal 6xHis-SUMO-tagged
• Expression Region: 638-767aa
• Protein Length: Partial
• MW: 30.7 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name, DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen, CD26 Cleaved into the following 3 chains, Dipeptidyl peptidase 4 membrane form Alternative name(s), Dipeptidyl peptidase IV membrane form Dipeptidyl peptidase 4 soluble form Alternative name(s), Dipeptidyl peptidase IV soluble form Dipeptidyl peptidase 4 60KDA soluble form Alternative name(s), Dipeptidyl peptidase IV 60KDA soluble form

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P14740