Rat Cfd protein

SKU: orb383468

Description

This Rat Cfd protein spans the amino acid sequence from region 26-263aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Baculovirus and Mammalian Cell N-terminal 10xHis-tagged and C-terminal Myc-tagged Full Length of Mature Protein

Key Properties

• Source: Mammalian cell
• Biological Origin: Rattus norvegicus (Rat)
• Tag: N-terminal 10xHis-tagged and C-terminal Myc-tagged
• Molecular Weight: 29.8 kDa
• Expression Region: 26-263aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: ILGGQEAMAHARPYMASVQVNGTHVCGGTLVDEQWVLSAAHCMDGVTKDEVVQVLLGAHSLSSPEPYKHLYDVQSVVLHPGSRPDSVEDDLMLFKLSHNASLGPHVRPLPLQREDREVKPGTLCDVAGWGVVTHAGRRPDVLQQLTVSIMDRNTCNLRTYHDGAITKNMMCAESNRRDTCRGDSGGPLVCGDAVEAVVTWGSRVCGNRRKPGVFTRVATYVPWIENVLSGNVSVNVTA
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Adipsin C3 convertase activator Endogenous vascular elastase Properdin factor D

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P32038