Rassf5 Rabbit Polyclonal Antibody

• Catalog Number: orb584411
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rassf5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat
• Reactivity: Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Rassf5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47kDa
• Target: Rassf5
• UniProt ID: Q5EBH1
• Protein Sequence: Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK
• NCBI: NP_061220
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: No, Nor, Rapl, Maxp1, Nore1, Nore1A, Nore1B, 13000
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Heart, Antibody dilution: 2 ug/ml.

Sample Type: Mouse Spleen lysates, Antibody dilution: 1.0 ug/ml.