Cart summary

You have no items in your shopping cart.

RARB Peptide - N-terminal region

RARB Peptide - N-terminal region

Catalog Number: orb2003781

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2003781
CategoryProteins
DescriptionRARB Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
Buffer/PreservativesLyophilized powder
Protein SequenceSynthetic peptide located within the following region: EKALKACFSGLTQTEWQHRHTAQSIETQSTSSEELVPSPPSPLPPPRVYK
UniProt IDP10826
MW49kDa
Tested applicationsWB
Application notesThis is a synthetic peptide designed for use in combination with RARB Rabbit Polyclonal Antibody (orb573746). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
NoteFor research use only