RAPGEF2 Rabbit Polyclonal Antibody

SKU: orb578594

Description

Rabbit polyclonal antibody to RAPGEF2

Research Area

Developmental Biology, Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse RAPGEF2
• Target: RAPGEF2
• Protein Sequence: Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
• Molecular Weight: 164kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

nR, CNRa, Pdzgef, RA-GEF, Pdzgef1, nRapGEP, CNRasGEF, RA-GEF-1, mKIAA0313, 5830453M24Rik

Sample Type: Mouse Brain lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-RAPGEF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-RAPGEF2 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Small Intestine, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

Quick Database Links

Gene Symbol

RAPGEF2

UniProt

Q8CHG7

RefSeq:XP_006502317.1