RAP1GAP Rabbit Polyclonal Antibody

• Catalog Number: orb583193
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAP1GAP
• Target: RAP1GAP
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAP1GAP
• Protein Sequence: Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA
• UniProt ID: P47736
• MW: 73kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RAPGAP, RAP1GA1, RAP1GAP1, RAP1GAPII
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_002876

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. RAP1GAP is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. RAP1GAP is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-RAP1GAP Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. RAP1GAP is supported by BioGPS gene expression data to be expressed in HEK293T.