RAN Rabbit Polyclonal Antibody

SKU: orb330885

Description

Rabbit polyclonal antibody to RAN

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN
• Target: RAN
• Protein Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
• Molecular Weight: 24kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

anti ARA24 antibody, anti Gsp1 antibody, anti TC4 antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

Rabbit Anti-RAN Antibody, Catalog Number: orb330885, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-RAN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

RAN

UniProt

P62826

RefSeq (Protein):NP_006316