Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAN Rabbit Polyclonal Antibody

SKU: orb330885

Description

Rabbit polyclonal antibody to RAN

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human RAN
TargetRAN
Protein SequenceSynthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA
Molecular Weight24kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti ARA24 antibody, anti Gsp1 antibody, anti TC4 antibody

Similar Products

  • TLR4 Rabbit Polyclonal Antibody [orb11489]

    FC,  ICC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Mouse, Porcine, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Ran Rabbit Polyclonal Antibody [orb402333]

    FC,  ICC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RANBP2 Rabbit Polyclonal Antibody [orb1676398]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • ADRM1/ARM-1/ARM Rabbit Polyclonal Antibody [orb865352]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RanBP1 Rabbit Polyclonal Antibody [orb19210]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RAN Rabbit Polyclonal Antibody

Sample Tissue: Mouse Spleen, Antibody dilution: 1 ug/ml.

RAN Rabbit Polyclonal Antibody

Rabbit Anti-RAN Antibody, Catalog Number: orb330885, Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue, Observed Staining: Nucleus, Cytoplasm, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

RAN Rabbit Polyclonal Antibody

WB Suggested Anti-RAN Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: HepG2 cell lysate.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_006316

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RAN Rabbit Polyclonal Antibody (orb330885)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry