You have no items in your shopping cart.
Cart summary
RALGPS1 Protein, Human, Recombinant (His & SUMO)
Catalog Number: orb2816106
| Catalog Number | orb2816106 |
|---|---|
| Category | Proteins |
| Description | RALGPS1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli with N-6xHis-SUMO. The accession number is Q5JS13. |
| Tag | N-6xHis-SUMO |
| Protein Sequence | MYKRNGLMASVLVTSATPQGSSSSDSLEGQSCDYASKSYDAVVFDVLKVTPEEFASQITLMDIPVFKAIQPEELASCGWSKKEKHSLAPNVVAFTRRFNQVSFWVVREILTAQTLKIRAEILSHFVKIAKKLLELNNLHSLMSVVSALQSAPIFRLTKTWALLNRKDKTTFEKLDYLMSKEDNYKRTREYIRSLKMVPSIPYLGIYLLDLIYIDSAYPASGSIMENEQRSNQMNNILRIIADLQVSCSYDHLTTLPHVQKYLKSVRYIEELQKFVEDDNYKLSLRIEPGSSSPRLVSSKEDLAAM |
| UniProt ID | Q5JS13 |
| MW | 50.7 kDa (Predicted) |
| Application notes | Reconstitute the lyophilized protein in sterile deionized water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Expression System | E. coli |
| Biological Origin | Human |
| Expression Region | 1-305 aa |
| Storage | -20°C |
| Note | For research use only |
