RAD23A monoclonal antibody (M01), clone 3C12

• Catalog Number: orb2292283
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAD23A.
• Species/Host: Mouse
• Clonality: Monoclonal
• Clone Number: 3C12
• Tested applications: ELISA, WB
• Reactivity: Human
• Isotype: IgG2a Kappa
• Immunogen: RAD23A (AAH14026, 151 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Conjugation: Unconjugated
• Protein Sequence: EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ
• NCBI: AAH14026
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Detection limit for recombinant GST tagged RAD23A is approximately 0.03 ng/ml as a capture antibody.

Western blot analysis of RAD23A over-expressed 293 cell line, cotransfected with RAD23A Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with RAD23A monoclonal antibody (M01), clone 3C12 (Cat # orb2292283). GAPDH (36.1 kDa) used as specificity and loading control.

Western Blot detection against Immunogen (36.63 KDa).