RAD17 Rabbit Polyclonal Antibody

SKU: orb573601

Description

Rabbit polyclonal antibody to RAD17

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Porcine, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAD17
• Target: RAD17
• Protein Sequence: Synthetic peptide located within the following region: PTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIEDYESDGT
• Molecular Weight: 66kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

CCYC, R24L, RAD24, HRAD17, RAD17SP

WB Suggested Anti-RAD17 Antibody, Positive Control: Lane 1: 25 ug Hela lysate, Lane 2: 25 ug HEK293T lysate, Lane 3: 25 ug Xenopus laevis egg extract, Lane 4: 25 ug mouse embryonic stem cells lysate, Primary Antibody Dilution: 1:500, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody Dilution: 1:3000.

WB Suggested Anti-RAD17 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate, RAD17 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells.

Quick Database Links

Gene Symbol

RAD17

UniProt

O75943

RefSeq (Protein):NP_579919