RABGGTA Rabbit Polyclonal Antibody

SKU: orb580663

Description

Rabbit polyclonal antibody to RABGGTA

Research Area

Epigenetics

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RABGGTA
• Target: RABGGTA
• Protein Sequence: Synthetic peptide located within the following region: ELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLKEL
• Molecular Weight: 65kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PTAR3

Sample Type: Hela, Antibody dilution: 1.0 ug/ml. RABGGTA is supported by BioGPS gene expression data to be expressed in HeLa.

WB Suggested Anti-RABGGTA Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. RABGGTA is supported by BioGPS gene expression data to be expressed in Jurkat.

Quick Database Links

Gene Symbol

RABGGTA

UniProt

Q92696

RefSeq (Protein):NP_878256