RABGAP1L Rabbit Polyclonal Antibody

• Catalog Number: orb326602
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RABGAP1L
• Target: RABGAP1L
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RABGAP1L
• Protein Sequence: Synthetic peptide located within the following region: EVVSLQRESDKEEPVTPTSGGGPMSPQDDEAEEESDNELSSGTGDVSKDC
• UniProt ID: Q5R372
• MW: 27kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HHL, TBC1D18
• Note: For research use only
• NCBI: NP_001030307.1

Sample Type: HT1080 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL.