You have no items in your shopping cart.
Cart summary
Rabbit IFN gamma protein
Catalog Number: orb1216319
| Catalog Number | orb1216319 |
|---|---|
| Category | Proteins |
| Description | The Rabbit IFN gamma yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Rabbit IFN gamma applications are for cell culture, ELISA standard, and Western Blot Control. The Rabbit IFN gamma yeast-derived recombinant protein can be purchased in multiple sizes. Rabbit IFN gamma Specifications: (Molecular Weight: 16.9 kDa) (Amino Acid Sequence: QDTLTRETEH LKAYLKANTS DVANGGPLFL NILRNWKEES DNKIIQSQIV SFYFKLFDNL KDHEVIKKSM ESIKEDIFVK FFNSNLTKMD DFQNLTRISV DDRLVQRKAV SELSNVLNFL SPKSNLKKRK RSQTLFRGRR ASKY (144)) (Gene ID: 100008602). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 16.9 kDa |
| Target | IFN gamma |
| Entrez | 100008602 |
| Protein Sequence | QDTLTRETEHLKAYLKANTSDVANGGPLFLNILRNWKEESDNKIIQSQIVSFYFKLFDNLKDHEVIKKSMESIKEDIFVKFFNSNLTKMDDFQNLTRISVDDRLVQRKAVSELSNVLNFLSPKSNLKKRKRSQTLFRGRRASKY (144) |
| Protein Length | 144 |
| Source | Yeast |
| Storage | -20°C |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 3
JAK2 antibody [orb318917]
IF, IH, WB
Human, Mouse, Porcine, Primate, Rabbit, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
- Item 1 of 2
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars