Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

Rab8b Antibody

SKU: orb334962

Description

Goat polyclonal antibody to mouse Rab8. Rab8 belongs to the small GTPase superfamily, Rab family. It has cell-type specific function during the process of exocytosis and coordinates regulation of the cytoskeleton. Rab8 also appears to interface with endocytic recycling circuits. At the molecular level, this GTPase regulates both the export of vesicles from the trans-Golgi apparatus, and the directed translocation along actin filaments and microtubules.

Research Area

Signal Transduction

Images & Validation

Tested ApplicationsWB
Dilution RangeWB:1:250-1:1,000
ReactivityBovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
Application Notes
The antibody solution should be gently mixed before use.

Key Properties

HostGoat
ClonalityPolyclonal
IsotypeIgG
ImmunogenAntigen: Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli. Antigen Sequence: MEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL
TargetRAB8B, member RAS oncogene family
PurificationEpitope affinity purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Form/AppearancePolyclonal antibody supplied as a 200 µl (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
ConcentrationPlease inquire
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

RAB8A, RAB8B, RAS-associated protein RAB8A, ras-related protein Rab-8B, ras-related protein Rab-8A, ras-related protein Rab-8B antibody.

Similar Products

  • RAB8B Rabbit Polyclonal Antibody [orb630454]

    ELISA,  IHC,  IP,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • Rab8 Antibody [orb153349]

    IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep

    Goat

    Polyclonal

    Unconjugated

    100 μg
  • RAB8B rabbit pAb Antibody [orb773009]

    ELISA,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RAB8B Antibody [orb524811]

    ELISA,  IHC

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • RAB8B Antibody [orb524812]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Rab8b Antibody

Western blot analysis of staining of GFP Rab8a lysate using Rab8b antibody

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

Rab8b Antibody (orb334962)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 280.00
Choose Conjugation or Carrier Free Version
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 2-3 days
Bulk Enquiry