Rab8b Antibody

SKU: orb334962

Description

Goat polyclonal antibody to mouse Rab8. Rab8 belongs to the small GTPase superfamily, Rab family. It has cell-type specific function during the process of exocytosis and coordinates regulation of the cytoskeleton. Rab8 also appears to interface with endocytic recycling circuits. At the molecular level, this GTPase regulates both the export of vesicles from the trans-Golgi apparatus, and the directed translocation along actin filaments and microtubules.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:250-1:1,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 107 aa to the C-terminus of mouse Rab8b produced in E. coli.. Antigen Sequence: MEEHASSDVERMILGNKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDSNSSGAGGPVKITESRSKKTSFFRCSLL
• Target: RAB8B, member RAS oncogene family
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

RAB8A, RAB8B, RAS-associated protein RAB8A, ras-related protein Rab-8B, ras-related protein Rab-8A, ras-related protein Rab-8B antibody.

Western blot analysis of staining of GFP Rab8a lysate using Rab8b antibody

Quick Database Links

Gene Symbol

RAB8B, member RAS oncogene family