You have no items in your shopping cart.
Cart summary
Item 1 of 1
RAB39A antibody
Catalog Number: orb330906
| Catalog Number | orb330906 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to RAB39A |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | WB |
| Predicted Reactivity | Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat |
| Reactivity | Equine, Guinea pig, Human, Mouse, Rat |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human RAB39 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 25kDa |
| Target | RAB39A |
| UniProt ID | Q8BHD0 |
| Protein Sequence | Synthetic peptide located within the following region: METIWIYQFRLIVIGDSTVGKSCLLHRFTQGRFPGLRSPACDPTVGVDFF |
| NCBI | NP_059986 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | anti RAB39 antibody Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Western blot analysis of Hela cell lysate tissue using RAB39A antibody
- Item 1 of 3
RAB39A/B Antibody [orb1728221]
ELISA, FC, ICC, IF, WB
Human
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μg - Item 1 of 1
- Item 1 of 1
- Item 1 of 1
- Item 1 of 1
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars