RAB33B Rabbit Polyclonal Antibody

• Catalog Number: orb584832
• Category: Antibodies
• Description: Rabbit polyclonal antibody to RAB33B
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish
• Reactivity: Human
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 26kDa
• Target: RAB33B
• UniProt ID: Q9H082
• Protein Sequence: Synthetic peptide located within the following region: ERIKIQLWDTAGQERFRKSMVQHYYRNVHAVVFVYDMTNMASFHSLPSWI
• NCBI: NP_112586
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SMC2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

RAB33B antibody - middle region (orb584832) validated by WB using Jurkat cell lysate at 1 ug/ml.

Sample Type: 1. Human Cervical Cancer Cell Lysate (15 ug), 2. Monkey Fibroblast Cell Lysate (15 ug), Primary dilution: 1:1000, Secondary Antibody: goat anti-RabbitSecondary dilution: 1:40000.