RAB31 monoclonal antibody (M03), clone 4D12

• Catalog Number: orb2291458
• Category: Antibodies
• Description: Mouse monoclonal antibody raised against a partial recombinant RAB31.
• Clonality: Monoclonal
• Species/Host: Mouse
• Isotype: IgG2a Kappa
• Conjugation: Unconjugated
• Reactivity: Human
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Immunogen: RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Protein Sequence: TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
• Tested applications: ELISA, IF, WB
• Clone Number: 4D12
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Note: For research use only
• NCBI: AAH01148

Immunofluorescence of monoclonal antibody to RAB31 on HeLa cell. [antibody concentration 10 ug/ml]

RAB31 monoclonal antibody (M03), clone 4D12. Western Blot analysis of RAB31 expression in Hela S3 NE.

Western Blot detection against Immunogen (36.63 KDa).