Rab20 Antibody

• Catalog Number: orb153329
• Category: Antibodies
• Description: Goat polyclonal antibody to RAB20. RAB20 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein localizes to Golgi apparatus and plays a role in apical endocytosis/recycling.
• Target: RAB20, member RAS oncogene family
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 130 aa to the C-terminus of Rab20 produced in E. coli.. Antigen Sequence: MEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
• Tested applications: WB
• Dilution range: WB:1:250-1:2,000
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Ras-related protein Rab-20 antibody.
• Note: For research use only

Western blot analysis of HEK293 cell line lysate using Rab20 antibody.