Rab20 Antibody

SKU: orb153329

Description

Goat polyclonal antibody to RAB20. RAB20 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein localizes to Golgi apparatus and plays a role in apical endocytosis/recycling.

Images & Validation

• Tested Applications: WB
• Dilution range: WB:1:250-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 130 aa to the C-terminus of Rab20 produced in E. coli.. Antigen Sequence: MEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
• Target: RAB20, member RAS oncogene family
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

Ras-related protein Rab-20 antibody.

Western blot analysis of HEK293 cell line lysate using Rab20 antibody.

Quick Database Links

Gene Symbol

RAB20, member RAS oncogene family