Rab20 Antibody

SKU: orb153329

Description

Goat polyclonal antibody to RAB20. RAB20 belongs to the large RAB family of low molecular weight GTPases that are involved in intracellular membrane trafficking. This protein localizes to Golgi apparatus and plays a role in apical endocytosis/recycling.

Images & Validation

• Tested Applications: WB
• Dilution Range: WB:1:250-1:2,000
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 130 aa to the C-terminus of Rab20 produced in E. coli. Antigen Sequence: MEGPASGKVGSCVSTKVPKQVQPEDAVALYKKILKYKMLDEREMPAAEQMCFETSAKTGYNVDLLFETLFDLVVPMIMRQRAEESDQTVDIASCKTPKQTRSGCCA
• Target: RAB20, member RAS oncogene family
• Purification: Epitope affinity purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Form/Appearance: Polyclonal antibody supplied as a 200 µl (2 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
• Concentration: Please inquire
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Ras-related protein Rab-20 antibody.

Western blot analysis of HEK293 cell line lysate using Rab20 antibody.

Quick Database Links

Gene Symbol

RAB20, member RAS oncogene family