Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

RAB1B Rabbit Polyclonal Antibody

SKU: orb585862

Description

RAB1B Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting RAB1B. It is suitable for WB and is reactive with human, mouse samples. Predicted reactivity includes Bovine, Canine, Equine, Guinea pig, Rat. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Cell Biology, Epigenetics & Chromatin, Molecular Biology, Stem Cell & Developmental Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
TargetRAB1B
Protein SequenceSynthetic peptide located within the following region: TSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPAGGG
Molecular Weight22kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • RAB1B Rabbit Polyclonal Antibody [orb692206]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • RAB1B Antibody (C-term) [orb1936382]

    IHC-P,  WB

    Porcine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • Rab 1B rabbit pAb Antibody [orb770528]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Recombinant

    Unconjugated

    50 μl, 100 μl
  • RAB1B Rabbit Polyclonal Antibody [orb630415]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • RAB1B Rabbit Polyclonal Antibody [orb515366]

    IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    30 μl, 100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

RAB1B Rabbit Polyclonal Antibody

Sample Tissue: Mouse Brain, Antibody dilution: 1 ug/ml.

RAB1B Rabbit Polyclonal Antibody

human Hela Cells and Monkey Vera.

RAB1B Rabbit Polyclonal Antibody

RAB1B antibody - C-terminal region (orb585862) validated by WB using Fetal Kidney Lysate at 1 ug/ml.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_112243

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

RAB1B Rabbit Polyclonal Antibody (orb585862)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry