Rab1b Antibody

SKU: orb420050

Description

Goat polyclonal antibody to Rab1b. Rab1b belongs to the small GTPase superfamily, Rab family. Rab1b together with Rab1a control vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.

Images & Validation

• Tested Applications: IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IHC-P:1:100-1:500, IHC-F:1:100-1:500
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Application Notes:
  The antibody solution should be gently mixed before use.

Key Properties

• Antibody Type: Primary Antibody
• Host: Goat
• Clonality: Polyclonal
• Isotype: IgG
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli.. Antigen Sequence: QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC
• Target: RAB1, member RAS oncogene family
• Purification: Epitope affinity purified

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Concentration: 1 mg/ml
• Disclaimer: For research use only

Alternative Names

RAB1A, RAB1B, RAS-associated protein RAB1A, ras-related protein Rab-1B, ras-related protein Rab-1A, ras-related protein Rab-1B, YPT1 antibody.

Quick Database Links

Gene Symbol

RAB1, member RAS oncogene family