Rab1b Antibody

• Catalog Number: orb420050
• Category: Antibodies
• Description: Goat polyclonal antibody to Rab1b. Rab1b belongs to the small GTPase superfamily, Rab family. Rab1b together with Rab1a control vesicle traffic from the endoplasmic reticulum to the Golgi apparatus.
• Target: RAB1, member RAS oncogene family
• Clonality: Polyclonal
• Species/Host: Goat
• Isotype: IgG
• Conjugation: Unconjugated
• Reactivity: Bovine, Canine, Donkey, Equine, Feline, Gallus, Goat, Guinea pig, Hamster, Human, Mouse, Other, Porcine, Primate, Rabbit, Rat, Sheep
• Concentration: 1 mg/ml
• Buffer/Preservatives: PBS, 20% glycerol and 0.05% sodium azide
• Immunogen: Antigen: Purified recombinant peptide derived from within residues 110 aa to the C-terminus of Rab1b produced in E. coli.. Antigen Sequence: QEIDRYASENVNKLLVGNKSDLTTKKVVDNTTAKEFADSLGVPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASGGERPNLKIDSTPVKPASGGCC
• Tested applications: IHC-Fr, IHC-P, WB
• Dilution range: WB:1:500-1:5,000, IHC-P:1:100-1:500, IHC-F:1:100-1:500
• Application notes: The antibody solution should be gently mixed before use.
• Antibody Type: Primary Antibody
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: RAB1A, RAB1B, RAS-associated protein RAB1A, ras-re
• Note: For research use only