RAB15 Rabbit Polyclonal Antibody

SKU: orb326053

Description

Rabbit polyclonal antibody to RAB15

Research Area

Signal Transduction

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB15
• Target: RAB15
• Protein Sequence: Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE
• Molecular Weight: 23kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

WB Suggested Anti-RAB15 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Human Placenta.

Quick Database Links

Gene Symbol

RAB15

UniProt

P59190

RefSeq (Protein):NP_941959