Rab13 Rabbit Polyclonal Antibody

• Catalog Number: orb578639
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Rab13
• Target: Rab13
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: TDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA
• UniProt ID: Q9DD03
• MW: 23kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: 0610007N03Rik, B230212B15Rik
• Research Area: Cancer Biology, Cell Biology, Epigenetics & Chroma
• Note: For research use only
• NCBI: NP_080953
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Mouse whole tissue extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

WB Suggested Anti-Rab13 Antibody, Titration: 1.0 ug/ml, Positive Control: Mouse Heart.