QPCT purified MaxPab mouse polyclonal antibody (B01P)

• Catalog Number: orb2291295
• Category: Antibodies
• Description: Mouse polyclonal antibody raised against a full-length human QPCT protein.
• Species/Host: Mouse
• Clonality: Polyclonal
• Tested applications: WB
• Reactivity: Human
• Immunogen: QPCT (NP_036545.1, 1 a.a. ~ 361 a.a) full-length human protein.
• Conjugation: Unconjugated
• Protein Sequence: MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL
• NCBI: NP_036545.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: In 1x PBS, pH 7.4
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

QPCT MaxPab polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.

Western Blot analysis of QPCT expression in transfected 293T cell line by QPCT MaxPab polyclonal antibody. Lane 1: QPCT transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.