You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2291296 |
---|---|
Category | Antibodies |
Description | Mouse polyclonal antibody raised against a full-length human QPCT protein. |
Clonality | Polyclonal |
Species/Host | Mouse |
Conjugation | Unconjugated |
Reactivity | Human |
Buffer/Preservatives | No additive |
Immunogen | QPCT (NP_036545, 1 a.a. ~ 361 a.a) full-length human protein. |
Protein Sequence | MAGGRHRRVVGTLHLLLLVAALPWASRGVSPSASAWPEEKNYHQPAILNSSALRQIAEGTSISEMWQNDLQPLLIERYPGSPGSYAARQHIMQRIQRLQADWVLEIDTFLSQTPYGYRSFSNIISTLNPTAKRHLVLACHYDSKYFSHWNNRVFVGATDSAVPCAMMLELARALDKKLLSLKTVSDSKPDLSLQLIFFDGEEAFLHWSPQDSLYGSRHLAAKMASTPHPPGARGTSQLHGMDLLVLLDLIGAPNPTFPNFFPNSARWFERLQAIEHELHELGLLKDHSLEGRYFQNYSYGGVIQDDHIPFLRRGVPVLHLIPSPFPEVWHTMDDNEENLDESTIDNLNKILQVFVLEYLHL |
Tested applications | WB |
Application notes | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Note | For research use only |
NCBI | NP_036545 |
QPCT MaxPab polyclonal antibody. Western Blot analysis of QPCT expression in HeLa.
Western Blot analysis of QPCT expression in transfected 293T cell line by QPCT MaxPab polyclonal antibody. Lane 1: QPCT transfected lysate(39.71 KDa). Lane 2: Non-transfected lysate.