PUS7 Rabbit Polyclonal Antibody

SKU: orb579738

Description

Rabbit polyclonal antibody to PUS7

Research Area

Molecular Biology

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat, Yeast, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PUS7
• Target: PUS7
• Protein Sequence: Synthetic peptide located within the following region: FADMMKHGLTEADVGITKFVSSHQGFSGILKERYSDFVVHEIGKDGRISH
• Molecular Weight: 75kDa
• Purification: Protein A purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

IDDABS

Sample Tissue: Human 786-0 Whole Cell, Antibody dilution: 1 ug/ml.

Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.

WB Suggested Anti-PUS7 Antibody Titration: 1.25 ug/ml, Positive Control: Transfected 293T.

Quick Database Links

Gene Symbol

PUS7

UniProt

Q96PZ0

RefSeq (Protein):NP_061915