PURA Rabbit Polyclonal Antibody

• Catalog Number: orb574556
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PURA
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PURA
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 35kDa
• Target: PURA
• UniProt ID: Q00577
• Protein Sequence: Synthetic peptide located within the following region: VEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYM
• NCBI: NP_005850
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PUR1, MRD31, PURALPHA, PUR-ALPHA
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5 ug/ml using anti-PURA antibody (orb574556).

WB Suggested Anti-PURA Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: MCF7 cell lysate, PURA is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells.